PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000935996
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 573aa    MW: 62901.3 Da    PI: 7.2787
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000935996genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.6e-33230287260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  MDP0000935996 230 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGNHNHPK 287
                    8****************************************.***************85 PP

2WRKY103.99.1e-33401459159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d ++v++tYeg+Hnh+
  MDP0000935996 401 LDDGYRWRKYGQKVVKGNPNPRSYYKCTYSGCSVRKHVERASHDLRAVITTYEGKHNHD 459
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-28221288IPR003657WRKY domain
SuperFamilySSF1182901.96E-25228288IPR003657WRKY domain
SMARTSM007749.2E-37229287IPR003657WRKY domain
PROSITE profilePS5081123.893230288IPR003657WRKY domain
PfamPF031061.2E-25230286IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.9E-37386461IPR003657WRKY domain
SuperFamilySSF1182906.67E-29393461IPR003657WRKY domain
PROSITE profilePS5081137.883396461IPR003657WRKY domain
SMARTSM007741.2E-37401460IPR003657WRKY domain
PfamPF031062.1E-25402459IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MASSSGSLET SANSHPAAFT FSTQPFMTTS FSDLLASGTD EDSNPPRYIG HGGLSDRIAE  60
RTGYGVPKFK SLPPPSLPIS PPSISPSSYF AIPPGLSPAE LLDSPVLLNT SNILPSPTTG  120
SFAAHGAFNW KNNQQNVKEE SKNYSDFSFQ TQARPPISSS SSMFQSSNTS IQTTQEQAWN  180
NYFQAQEPPK QEYGSVQSLS SEMTTKTLQN NTPANGGFYH QSQTLSRKSD DGYNWRKYGQ  240
KQVKGSENPR SYYKCTYPNC PTKKKVERSL DGQITEIVYK GNHNHPKPQN TRRSSSNSHA  300
IPASDPTNNE LPDQTYANHG NSQMDSIGTP ENSSISIGDD DFEQSSQRSK SGGGEEFDED  360
EPNAKKWKKE ADHNEGISAP GGRTVREPRV VVQTTSDIDI LDDGYRWRKY GQKVVKGNPN  420
PRSYYKCTYS GCSVRKHVER ASHDLRAVIT TYEGKHNHDV PAARGSGSHA AANRPIPNNN  480
NNNVASAMRT ITHHTNNSAN TNSLQNLRQP TSEGQAPFAV LEMLQSQGTY GFAGFDGNSM  540
GSYMNQTQXS DNMFSKAKEE PRDDAFFESL LR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-36230462878Probable WRKY transcription factor 4
1wj2_A2e-36230462878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158570.0cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008384716.10.0PREDICTED: probable WRKY transcription factor 26
TrEMBLD9ZJF20.0D9ZJF2_MALDO; WRKY domain class transcription factor
STRINGGLYMA02G39870.10.0(Glycine max)
STRINGGLYMA14G38010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-111WRKY DNA-binding protein 33